Introduction
The
Pumilio2 (
Pum2) gene is a mammalian member of the classical RNA binding protein family, the PUF family (Pumilio and FBF). The PUF family genes are widely present in eukaryotes, from yeast to mammals. The
Pumilio gene was first identified in Drosophila by Lehmann and Nüsslein-Volhard in 1987
[1]. In
C. elegans, FBF (for fem-3 binding factor) was reported as a homolog of Drosophila
Pumilio in 1997
[2]. FBF and Pumilio homologs hence constitute a large and evolutionarily conserved RNA binding protein family, thereafter called the PUF family. The PUF family is characterized by its highly conserved RNA binding domain PUM-HD (Pum Homolog Domain). PUM-HD consists of eight Puf repeats with about 40 amino acids each repeat and is essential for RNA binding by the PUF protein
[2–
4]. Furthermore, PUM-HD is reported to interact with other proteins
[5–
6]. Members of the PUF family modulate target gene expression at post-transcriptional levels
via binding to the PBE (PUM Binding Element) motif (UGUAHAUA) in the 3′UTR of target transcripts, and thus regulate developmental processes among various organisms
[7–
8].
Invertebrate members of the PUF family play significant roles in embryogenesis and germ cell development.
Drosophila Pumilio protein controls anterior-posterior axis formation, maintenance of germline stem cells and neuron development
via post-transcriptional regulation
[9–
14]. In
C. elegans, FBF1 and FBF2 are involved in the regulation of sperm-oocyte switch, maintenance of germline stem cell and the size of germline mitotic region
[2,
5,
15–
16]. These findings suggest that highly conserved mammalian PUM proteins may also play important roles in development
[8,
17].
Previously mouse
Pum2XE772/XE772 mutation was reported to affect nervous system function and testis size but not fertility or viability in mice
[18–
19]. This
Pum2 mutation resulted from a gene trap mutation where the β-geo gene was inserted between exon10 and exon11 of
Pum2. The insertion mutation led to a PUM2-β-geo fusion protein, removing most part of PUM2 protein after exon 10 including the most conserved PUM-HD domain
[18]. While this
Pum2 allele should disrupt the key function of PUM2 protein in its ability to bind its target sequences, it remains unknown if all the other functions of PUM2 were also disrupted and if the chimeric PUM2-β-geo fusion protein might impact the phenotype of
Pum2 allele. Furthermore, recent studies reported that PUM2 together with PUM1 regulates neurogenesis
[20], indicating a need to generate a conditional
Pum2 allele for simultaneous study of both
Pum1 and
Pum2 in specific tissues of interest. We hence seek to generate a new loss-of-function
Pum2 allele, which removes all parts of PUM2 protein and could be used for conditionally removing
Pum2 in any tissues for future characterization of PUM family protein function.
We succeeded in establishing a complete loss-of-function allele of Pum2 and the usability for conditional knockout of Pum2 in the presence of Cre recombinase. Whole body knockout of Pum2 led to reduced bodyweight and reduced testis size, similar to the previous Pum2 gene trap allele. However, this new mutation also reduced male fertility and viability slightly, suggesting key roles of PUM2 in maintaining normal male fertility and viability.
Materials and methods
Animals
Mice were housed and maintained on a 12 h-light-12 h-dark cycle with free access to water and food under the specific pathogen-free conditions in Animal Core Facility of Nanjing Medical University, China. All animal experiments were approved by the Institutional Animal Care and Use Committee (IACUC) of Nanjing Medical University and Northwestern University. Pum2 mutant mice used for analysis were on C57BL/6 (Jackson Laboratory, #000664) background.
Generation of Pum2 mutant mice
The
Pum2 strain was created from ES cell clones Pum2 (EPD0270) B04, Pum2 F03, obtained from KOMP repository and generated by Welcome Trust Sanger Institute
[21]. The cassette is composed of an FRT site followed by lacZ sequence and a loxP site. This first loxP site is followed by neomycin under the control of the human beta-actin promoter, SV40 polyA, a second FRT site and a second loxP site. A third loxP site is inserted at the position of 207 bp downstream of the targeted exons 6 and 7. The target region, exon6 and exon7, was flanked by two loxP sites and the selection cassette was flanked by
FRT sites (
Fig. 1A). Blastocyst injection and derivation of chimera were done at Northwestern University Transgenic Core facility. We first injected the ES cell clone into C57BL/6 blastocyst to get a chimeric mouse and backcrossed the chimeric mice to establish a colony of mice that transmitted the targeting construct
Pum2nf gene in the germ line. Then, the
Pum2nf/+ mice were mated with CAG-flip (C57BL/6) (to delete the selection cassette) and Ella-Cre (C57BL/6) (to delete exons 6 and 7) to generate mouse with the
Pum2F and
Pum2− alleles, respectively. All offspring were genotyped by PCR using primers shown in
Fig. 1A.
Genotyping of Pum2 mutant mice by genomic PCR
Genomic DNA was extracted from tail tip for genotyping. Pum2-F1, Pum2-R1 and Pum2-FrtR were used for detecting the wild-type allele (Pum2+, 175bp) and the Frt-Neo-Frt-loxP cassette-containing allele (Pum2nf, 310bp). Genotyping primers for the wild-type allele (Pum2+, 132bp), the loxP-Exon6-Exon7-LoxP (Pum2LoxP hereafter referred to as Pum2F, 271bp) and the deletion allele (Pum2−, 210bp) are Pum2-F3, Pum2-R2, Pum2-KOR and Pum2-loxR. Target regions were amplified by GoTaq Green master mix (Promega). All primers for genotyping are presented in Table 1.
RNA was extracted by using TRIzol Reagent (Invitrogen) according to the manufacturer’s instructions and measured by Nanodrop 2000 (Thermo). Reverse transcription (RT) was carried out following standard procedures using random primers and PrimeScript RT Master Mix (Takara) (Table 2).
Testes were collected from adult Pum2+/+, Pum2−/−, Pum2nf/nf, and Pum2XE772/XE772 mice. All samples were lysed in RIPA buffer containing protease inhibitor (5 mg/mL final concentration). After incubation for 15 min on ice, the tissue lysates were centrifuged at 20,000 g for 30 min at 4°C and then the supernatant was carefully collected. The lysates were subjected to SDS-PAGE followed by immunoblotting. Proteins were separated by 12% SDS-PAGE gels and transferred to PVDF membranes (Bio-Rad). The membrane was blocked with 10% (w/v) skim milk powder in TBS (100 mmol/L Tris-HCl, pH7.3) containing 0.1% (v/v) Tween 20 (TBST) for 1 h and then incubated with anti-PUM2 antibody (1:500, Bethyl laboratory) or anti-β-actin antibody (1:2,000, Sigma) at 4°C overnight. After three washes (5 min each) with 1 × TBST, the membranes were incubated with a secondary antibody conjugated with horseradish peroxidase for 1 h at room temperature, followed by washing. Protein bands were detected by using ECL Western blotting reagents (Thermo) for exposure.
Bodyweight and fertility measurement
Bodyweight was measured weekly from newborn to adult stage for the three genotypes (Pum2+/+, Pum2+/−, Pum2−/−). Eight-week-old males or six-week-old females were housed singly with wildtype ICR females or ICR males of proven fertility for at least 6 months. A total of 6 Pum2−/−, 4 Pum2+/− and 3 Pum2+/+ mice were tested in both males and females. The litter sizes were recorded continuously.
Histology analyses
Tissues were fixed for 24 h in Hartman’s fixative (Sigma). Paraffin embedded sections (5 mm) were stained with hematoxylin and eosin (H&E) and images were obtained with microscope (Zeiss, Axioscope) and processed using the AxioVision LE software.
Sperm count and sperm motility assay
The number of sperm was counted via a hemocytometer as follows: one caudal epididymis was collected and dissected into numerous smaller pieces in 1 mL pre-warmed (37°C) 1 × PBS and followed by incubation at 37°C for 30 min to allow sperm release. Sperm motility was analyzed by using the computer-assisted sperm analysis (CASA, HamiltonThorne, TOX IVOS) system after 5 min incubation at 37°C.
Results
Generation of a conditional Pum2 allele
Pum2 ES clone containing the target Pum2 allele was injected in C57BL/6 blastocyst, and the resulting chimera was crossed with C57BL/6 mice to generate Pum2nf allele (LacZ-Neo-LoxP allele), a knockout allele containing neomycin cassette and loxP insertions in the Pum2 locus (Fig. 1A). Pum2nf/+ mice were crossed to CAG-flip mice to generate Pum2F allele (Flox allele) at the same time. Pum2+/− mouse was generated after crossing Ella-CRE with Pum2F/F mouse, confirming the usability of floxed Pum2 allele for conditional knockout via Cre recombinase (Fig. 1A). Pum2−/−, Pum2nf/nf, Pum2f/f and their heterozygotes could be distinguished via PCR genotyping (Fig. 1B).
To confirm the deletion of exon6 and exon7 in Pum2 homozygotes, we extracted RNA and protein from adult Pum2+/+ and Pum2−/− testes. No transcripts containing exon 6 or 7 were present in the mutant tissues as RT-PCR using primers from exon 6 or 7 failed to detect any product (Fig. 1C). Despite deletion of exons 6 and 7, Pum2−/− mice still produced a shorter Pum2 transcript. However this mutant transcript is predicted to only produce a greatly truncated PUM2 (191 aa; MNHDFQALALESRGMGELLPTKKFWEPD DSTKDGQKGIFLGDDEWRETAWGTSHHSMSQP IMVQRRSGQSFHGNSEVNAILSPRSESGGLGVS MVEYVLSSSPADKLDSRFRKGTFGTRDAETDG PEKGDQKGKASPFEEDQNRDLKQDDEDSK INGRGLPNGMDADCKDFNWCILSRPCSSCICAKS IYY*) without most part of PUM2 including PUM-HD, due to a reading frame shift and a premature stop codon after exon 5. Thus, we generated a novel Pum2 allele lacking wildtype Pum2 transcripts.
We next determined if PUM2 was completely knocked out. We examined PUM2 expression in the testes of wildtype and three Pum2 mutants. The Pum2nf allele was the initial knockout allele produced from chimeric founder mice. It is similar to the gene trap allele, disrupting the expression of Pum2 but without signs of fusion protein. Indeed, PUM2 protein was completely absent in Pum2-/- and Pum2nf/nf testes whereas the PUM2-β-geo fusion protein was abundant in Pum2XE772/XE772 (Fig. 2A). Further examination of PUM2 in other tissues (brain, thymus, liver, spleen, lung, kidney and ovary) validated complete loss of PUM2 in all the tissues examined (Supplementary Fig S1, available online). Given our antibodies recognize only the N-terminus of PUM2 (100 to 150 amino acids of PUM2), failure to detect any PUM2 bands of the predicted truncated protein on Western bots indicated that no truncated or residual PUM2 protein was produced from the new Pum2 mutant tissues. We hence generated a complete loss-of-function Pum2 allele.
Pum2 is required for normal growth in mice
Previous study reports that
Pum2XE772/XE772 mice show reduced bodyweight
[18]. We found that the new
Pum2−/− homozygous mice were similar to wildtype in overall morphology (data not shown) and also showed reduced bodyweight from 1 week to 12 weeks of age in males (
Fig. 2B). These data suggest that loss of
Pum2 impacted male bodyweight during postnatal mouse growth. The difference in sexes could be due to sample size and can be further examined with a larger number of animals. Indeed, for mice 20-week old or older, both male and female
Pum2−/−mice showed small yet significant reduction of bodyweight than their wild type counterparts, confirming bodyweight reduction was not restricted to males.
We also noticed slightly reduced number of Pum2−/− (18.4%) among the pups produced from heterozygote interbreeding (Table 3). Although the number of offspring analyzed remained small, this significant deviation from Mendelian ratio may suggest a role of PUM2 in growth control.
Reduced fertility of Pum2−/− mutant males
Adult Pum2−/− males exhibited smaller testes than those of Pum2+/+, similar to t Pum2XE772/XE772 (Fig. 3A). Testis weight of both Pum2+/− and Pum2−/− was reduced (Fig. 3B). To exclude the effect from the overall bodyweight reduction, we measured the ratio of testis weight over bodyweight and found that it was also significantly reduced in Pum2+/− and Pum2−/− mice than that of wildtype mice (Fig. 3C). Histological examination of mutant testes showed a small increase in the number of degenerating tubules in the testis, suggesting a possible cause of testis weight reduction (Fig. 3D). Examination of apoptotic cells in the testis did not reveal any significant difference between wildtype and Pum2−/− (Supplementary Fig. 2A, B and C, available online). Other than degenerated tubules, spermatogenesis stages were similar in both wildtype and Pum2− / −based on histological staging of the testes (Fig. 3E).
We further examined the fertility of Pum2−/− males, by mating 8-week-old Pum2+/+, Pum2+/− and Pum2−/− males with wildtype females. Our results showed that loss of Pum2 also reduced male fertility (Fig. 4A). Pum2−/− males showed reduced sperm count (Fig. 4B); however, sperm motility and sperm morphology Pum2 homozygotes appeared normal (Fig. 4C and Supplementary Fig. 2D, available online). These data suggested that Pum2 was required for normal male fertility.
Pum2 is dispensable for female fertility
Pum1, another member of Puf family, is an important translational regulator for mammalian female germ cell development
[22]. To analyze roles of
Pum2 in female mice, 6-week-old
Pum2 mutant female mice were crossed to wildtype males. There was no significant difference in female fertility (
Supplementary Fig. 3A, available online) and ovary weight (
Supplementary Fig. 3B, available online). The number of developing follicles and corpus luteum in adult
Pum2−/− ovaries was comparable to age-matched
Pum2+/+ ovaries (
Supplementary Fig. 3C, available online). Further supporting this notion, superovulation experiments revealed that the number of MII oocytes retrieved from 3-month-old
Pum2−/− females was similar to age-matched
Pum2+/+ females (
Supplementary Fig. 3D, available online), suggesting that Pum2 is dispensable for female fertility, consistent with the previous report
[22].
Our work suggests that Pum2, a member of the conserved mammalian PUF family, is needed for attaining normal viability and male fertility, but is not essential for female fertility.
Discussion
RNA binding proteins have been found to play important roles in diverse physiologic processes as well as in human diseases. Recently, highly conserved RNA binding proteins-PUMILIO proteins were reported to be important for neurogenesis, germline development, genomic stability and hematopoietic stem cell proliferation
[20,
22–
25]. Physiologic function of
Pumilio has not been fully characterized yet. Our understanding of PUM2 has mainly come from a gene trap mutation, which disrupted the critical RNA binding ability of PUM2 but still produced a PUM2-β-geo fusion protein containing N-terminal PUM2
[18]. Thus, we constructed another
Pum2 mutant allele-
Pum2−/−, producing no PUM2. Complete absence of wildtype
Pum2 transcripts and absence of any PUM2 residual protein indicated that we have generated a
Pum2 null allele.
We confirmed the previous reports that
Pum2 is not essential for female fertility but is required for attaining normal bodyweight and testis weight
[18–
19,
22]. The small effect that
Pum2 mutation has on viability and male fertility revealed potential roles of PUM2 in growth and spermatogenesis. We failed to detect any increase in apoptosis in
Pum2 mutant testes, suggesting the reduction of testis weight may not result from apoptosis. Further investigation may be needed to pinpoint the contribution of other causes such as reduced proliferation toward reduced male fertility. PUM1 was reported to play an important role in safeguarding spermatogenesis
[26] and
Pum1 mutants are reduced in bodyweight
[26–
27]. We hence hypothesize that
Pum1 and
Pum2 may both regulate viability and male fertility together. Removal of both
Pum1 and
Pum2 altogether using conditional alleles in particular tissues such as the testis could help uncover fundamental roles of the conserved PUF family proteins.
Overall,
Pum2−/− mutant mice is similar to
Pum2XE772/XE772 in that they both exhibit reduced bodyweight, testis weight and sperm count
[18–
19], validating that the gene trap
Pum2XE772 allele is a strong loss-of-function allele. However,
Pum2−/− males displayed male subfertility and underrepresentation of homozygotes among the progeny. Such difference could result from the allelic difference due to the presence of part of PUM2 in the chimeric protein of the gene trap mutant; alternatively, it could result from a difference in mouse strain background as
Pum2−/−is in C57BL/6 background, but the gene trap allele used for fertility analysis was in mixed B6 and 129 background
[18]. Phenotypic comparison of transheterozygotes and individual homozygotes could distinguish the two possibilities. Regardless, generation of this conditional null
Pum2 allele established the functional requirement of mouse
Pum2 gene and provided a key model for future characterization of the role of the PUF family proteins in diverse biological processes.
2018 by the Journal of Biomedical Research.